PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G038303_P01
Common NameLOC100280919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NF-YA
Protein Properties Length: 301aa    MW: 32792.1 Da    PI: 7.6771
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G038303_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.32.5e-33154210158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep+YVNaKQy++Il+RRq+Rakle+++k+  k+rkpylheSRh+hA++R+RgsgGrF
  GRMZM2G038303_P01 154 EEPIYVNAKQYHAILRRRQTRAKLEAQNKM-VKGRKPYLHESRHRHAMKRARGSGGRF 210
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-37152213IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.459153213IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-28155210IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-25156178IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860158178IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.3E-25187210IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MCLLREMEDH YVHPKSKSNH GSLSGNGYEM KNPGHEVCDR DSSSESDRSH PEASAVSESS  60
LDEHTSTQSD NDEDHGKDNQ DTLKPVLSLG KEGSAFLAPK IDYNPSFAYI PYTADAYYGG  120
VGVLTGYAPH TIVHPQQNDT TNSPVMLPAE PAEEEPIYVN AKQYHAILRR RQTRAKLEAQ  180
NKMVKGRKPY LHESRHRHAM KRARGSGGRF LNTKQQPQEQ NQQYQASSGS MCSKTIGNSV  240
ISQSGPICTP SSDAAGASAA SQDRGCLPSV GFRPTANFSE QGGGGSKLVV NGMQQRVSTI  300
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-24154234278NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194203RHRHAMKRAR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.854460.0ear| embryo| endosperm| meristem| pedicel| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G038303
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G038303_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387090.0BT038709.1 Zea mays full-length cDNA clone ZM_BFb0310L05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008651394.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_008651393.10.0PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
TrEMBLB4FNM10.0B4FNM1_MAIZE; Uncharacterized protein
STRINGGRMZM2G038303_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Representative plantOGRP1192546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.16e-38nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]